Formalin-fixed, paraffin-embedded human GIST stained with Canine1 Monoclonal Antibody (DG1/447 + Canine1.1).
Formalin-fixed, paraffin-embedded human GIST stained with Canine1 Monoclonal Antibody (DG1/447 + Canine1.1).

Anti-DOG-1 / TMEM16A / ANO1 Antibody Clone DG1/447 + DOG-1.1

$ 429.00
Please Select Product Options Below To View The Catalog Number.

SKU: 55107-MSM3
Species: Human
Tested Applications: Flow Cytometry, Immunofluorescence, Immunohistochemistry (IHC)
Available Conjugates: Unconjugated
Isotype: Mouse IgG
Mass Spec Validated?: Not MS Validated

Product NumberDescriptionPrice
55107-MSM3-P1 Size: 100 ug, Tag: Unconjugated
Shipping Information
In Stock.
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:


Bioactivity (test results eg. IU/ml):

SKU: 55107-MSM3-P1
DOG-1 / TMEM16A / ANO1 General Information
Alternate Names
Transmembrane member 16A, TMEM16A, Canine1, Anoctamin-1, ANO1
Molecular Weight
Chromosomal Location
Curated Database and Bioinformatic Data
Gene SymbolTMEM16A
Entrez Gene ID55107
Ensemble Gene IDENSG00000131620
RefSeq Protein Accession(s)XP_006718665, XP_006718668, XP_011543433, XP_011543425, XP_011543426, XP_011543431, XP_011543423, XP_016873445, XP_016873446, XP_006718667, XP_011543430, XP_011543427, XP_011543429, NP_060513, XP_011543428
RefSeq mRNA Accession(s)XM_011545121, XM_011545128, NR_030691, XM_011545124, XM_011545131, XM_006718602, XM_011545123, XM_011545126, XM_011545127, XM_006718604, XM_011545129, XM_017017957, NM_018043, XM_006718605, XM_011545125, XM_017017956
RefSeq Genomic Accession(s)NC_018922, NC_000011
UniProt ID(s)Q9NW72, Q5XXA6
UniGene ID(s)Q9NW72, Q5XXA6
HGNC ID(s)21625
Cosmic ID(s)ANO1
KEGG Gene ID(s)hsa:55107
PharmGKB ID(s)PA164715378
General Description of DOG-1 / TMEM16A / ANO1.
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of Canine1, c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.

Human Anti-DOG-1 / TMEM16A / ANO1 Antibody Product Attributes

Species: Human
Tested Applications: Flow Cytometry, Immunofluorescence, Immunohistochemistry (IHC).
Application Notes: Flow Cytometry (0.5-1ug of antibody/million cells in 0.1ml), Immunofluorescence (0.5-1ug of antibody/ml), Immunohistochemistry (IHC) (Formalin-fixed) (0.25-0.5ug of antibody/ml for 30 minutes at RT)
Clonality: Monoclonal
Anti-DOG-1 / TMEM16A / ANO1 Antibody Clone: DG1/447 + DOG-1.1
Clone DG1/447 + DOG-1.1 Host and Isotype: Mouse IgG
Anti-Human DOG-1 / TMEM16A / ANO1 Positive Control Sample: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis, mast cells in the dermis of normal skin.
Cellular Localization of Antibody Cell Surface, Cytoplasm
Buffer and Stabilizer: 10mM PBS with 0.05% BSA & 0.05% azide.
Antibody Concentration: 200ug/ml
Antibody Purification Method:Protein A/G Purified
Immunogen: Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
Storage Conditions: Store at 2 to 8° C (refrigerate). Stable for 24 months when properly stored.

DOG-1 / TMEM16A / ANO1 Previously Observed Antibody Staining Patterns

Limitations and Warranty

enQuire Bio's DOG-1 / TMEM16A / ANO1 Anti-Human Monoclonal is available for Research Use Only. This antibody is guaranteed to work for a period of two years when properly stored.

There are no reviews yet.

Be the first to review “Anti-DOG-1 / TMEM16A / ANO1 Antibody Clone DG1/447 + DOG-1.1”

Your email address will not be published.

Share a Protocol (View Reviewed Protocols Below)

Protocol Title




  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Anti-DOG-1 / TMEM16A / ANO1 Antibody Clone DG1/447 + DOG-1.1