enQuire Bio » Products » Recombinant Protein » Recombinant Human Peptide YY Protein
Placeholder

Recombinant Human Peptide YY Protein

$ 88.00 – $ 1,618.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP8740
Species: Human
Available Tags: GST
Host: E. coli
Purity: Greater than 90% as determined by SDS-PAGE.
Length (Amino Acids): 37

Product NumberDescriptionPrice
QP8740-ec-10ug Size: 10 ug, Tag: GST $ 88.00
QP8740-ec-50ug Size: 50 ug, Tag: GST $ 218.00
QP8740-ec-100ug Size: 100 ug, Tag: GST $ 348.00
QP8740-ec-200ug Size: 200 ug, Tag: GST $ 568.00
QP8740-ec-500ug Size: 500 ug, Tag: GST $ 988.00
QP8740-ec-1mg Size: 1 mg, Tag: GST $ 1,618.00
Shipping Information
7-10 days
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP8740-ec-10ug
Recombinant Human Peptide YY Protein (34-70aa) General Information
Alternate Names
PYY1; PYY-I
Curated Database and Bioinformatic Data
Gene SymbolPYY
Entrez Gene ID5697
Ensemble Gene IDENSG00000131096
RefSeq Protein Accession(s)NP_004151.3
RefSeq mRNA Accession(s)NM_004160.5, XM_011525035.1
UniProt ID(s)P10082
UniGene ID(s)Hs.169249
HGNC ID(s)HGNC:9748
COSMIC ID Link(s)PYY
KEGG Gene ID(s)hsa:5697
PharmGKB ID(s)PA34090
General Description of Recombinant Human Peptide YY Protein (34-70aa).
This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.

Human Peptide YY Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant Peptide YY based upon sequence from: Human
Host: QP8740 protein expressed in E. coli.
Tag: GST
Protein Construction: A DNA sequence encoding the Homo sapiens (Human) Peptide YY, was expressed in the hosts and tags indicated. Please select your host/tag option, above.
Application Notes: Please contact us for application specific information for QP8740.
Bioactivity Data: Untested
Full Length? Updated: Partial
Expression Region: Updated: Ile31 - Tyr64
Amino Acid Sequence: Updated: IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
Purity: Greater than 90% as determined by SDS-PAGE.
Reconstitution Instructions:
Concentration of Human Peptide YY Protein:
Endotoxin Levels: Not determined.
Buffer: Tris-based buffer, 50% glycerol
Storage Conditions: Store at -20C to -80C.

Limitations and Performance Guarantee

This is a life science research product (for Research Use Only). This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human Peptide YY Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes

  protocol submission gif

Related Products

-
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Human Peptide YY Protein