Human OTOR Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant OTOR based upon sequence from Human
Host: QP12938 protein expressed in E. Coli.
Available Tags: Untagged, His
Protein Construction: A cDNA sequence encoding the sequence of OTOR was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Otoraplin in sterile 18MΩ.cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: Untested
Amino Acid Sequence: VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
Purity: Greater than 98.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The OTOR protein was lyophilized from a concentrated (1 mg/ml) solution containing 20mM PBS pH 7.4 and 130mM NaCl.
Storage Conditions: Lyophilized OTOR Recombinant although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OTOR should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Recombinant Human OTOR General Information | |
---|---|
Alternate Names | |
Otoraplin, Fibrocyte-derived protein, Melanoma inhibitory activity-like protein, OTOR, MIAL, FDP, MIAL1, MGC126737, MGC126739. | |
Molecular Weight | |
12.7 kDa | |
Chromosomal Location | |
p12.1 on chromosome 20 | |
Curated Database and Bioinformatic Data | |
Gene Symbol | OTOR |
Entrez Gene ID | 56914 |
UniProt ID(s) | Q9NRC9 |
COSMIC ID Link(s) | OTOR |
KEGG Gene ID(s) | hsa:56914 |
General Description of Recombinant Human OTOR. | |
Human Otoraplin produced in E. Coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.7 kDa. The OTOR is purified by using an optimized multi-step FPLC method for maximum separation from contaminants. |
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Reviews
There are no reviews yet.