Recombinant Rat RAP Protein

Price range: $ 89.00 through $ 2,800.00

SKU: QP13264
Species: Rat
Applications: See Application Notes
Available Tags: His
Available Hosts: E. Coli
Purity: Greater than 95.0% as determined by SDS-PAGE.
Length (Amino Acids):

SKU: QP13264-5ug Categories: , , , , Tag:
 PDF Datasheet

Rat RAP Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant RAP based upon sequence from Rat
Host: QP13264 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of RAP was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes

Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized RAP Rat in sterile 18MΩ.cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Additional Information: Ligand binding to RAP is Ca2+ dependent and e. g. lipid receptors can be released from RAP by a buffer containing 10mM EDTA. Furthermore, buffers containing phosphate should be avoided (it would form precipitates with Ca2+).
Bioactivity Data: Untested
Amino Acid Sequence: MAPLRDRVSTLPRLQLLVLLLLPLLLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRME KLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDGDGEKEAKLVHNLNV ILARYGLDGRKDTQTVHSNALNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFL HYKEKIHEYNVLLDTLSRAEEGYENLLSPSDMTHIKSDTLASKHSELKDRLRSINQGLDR LRKVSHQGYGPATEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQ LEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Purity: Greater than 95.0% as determined by SDS-PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The protein (1 mg/ml) was lyophilized after from a sterile solution containing TBS pH 7.5, 0.1% BSA and 0.09% NaN3.
Storage Conditions: Lyophilized RAP Rat although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution RAP Rat should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Size

, ,

Tag

Applications

Product Type

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Rat RAP Protein