Human GMFB Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant GMFB based upon sequence from Human
Host: QP12004 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of GMFB was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized GMFB in sterile 18MΩ.cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: Untested
Amino Acid Sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH
Purity: Greater than 98.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl.
Storage Conditions: Lyophilized GMF-B although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GMF-beta should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Recombinant Human GMFB General Information | |
---|---|
Alternate Names | |
Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF. | |
Molecular Weight | |
16.5 kDa | |
Curated Database and Bioinformatic Data | |
UniProt ID(s) | P60983 |
General Description of Recombinant Human GMFB. | |
Human Glia Maturation Factor-Beta (GMF-Beta) Human Recombinant produced in E. Coli is a single, non-glycosylated, polypeptide chain containing 141 amino acids and having a total molecular mass of 16.5 kDa. Glia Maturation Factor-Beta, GMF-Beta, is purified by using an optimized multi-step FPLC method for maximum separation from contaminants. |
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Reviews
There are no reviews yet.