PDF DatasheetHuman FSH Bioactive Protein Product Attributes
Product Type: Bioactive Protein
Recombinant FSH based upon sequence from Human
Host: QP10620 protein expressed in HEK 293.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of FSH was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Follicle Stimulating Hormone in sterile 18MΩ.cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: The ED50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml.
Monomer or Dimer: Dimer
Amino Acid Sequence: FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSFSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin Levels: < 1.0 EU per ug protein as determined by the LAL method.
Buffer: The recombinant FSH was lyophilized from a concentrated (1 mg/ml) solution containing PBS.
Storage Conditions: Lyophilized recombinant FSH although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FSH should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
| Recombinant Human FSH General Information | |
|---|---|
| Alternate Names | |
| Follitropin subunit beta, Follicle-stimulating hormone beta subunit, FSH-beta, FSH-B, Follitropin beta chain, FSH. | |
| Curated Database and Bioinformatic Data | |
| UniProt ID(s) | P01225 |
| General Description of Recombinant Human FSH. | |
| Human FSH Human Recombinant produced in HEK-293 cells is heterodimeric, glycosylated, polypeptide chain transfected with two expression plasmids encoding the human FSH-alpha chain (Accession # P01215) (Ala25-Ser116) and human FSH-beta chain (Asn19-Glu129) (Accession # P01225) having a total MW of 38kDa. FSH is purified by using an optimized multi-step FPLC method for maximum separation from contaminants. | |
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
There are no reviews yet.