Recombinant Human FSH Protein

Price range: $ 89.00 through $ 5,200.00

SKU: QP10620
Species: Human
Applications: Bioactive
Available Tags: Untagged
Available Hosts: HEK 293
Purity: Greater than 95% as determined by SDS-PAGE.
Length (Amino Acids):

SKU: QP10620-2ug Categories: , , , , Tag:
 PDF Datasheet

Human FSH Bioactive Protein Product Attributes

Product Type: Bioactive Protein
Recombinant FSH based upon sequence from Human
Host: QP10620 protein expressed in HEK 293.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of FSH was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes

Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Follicle Stimulating Hormone in sterile 18MΩ.cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: The ED50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml.
Monomer or Dimer: Dimer
Amino Acid Sequence: FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSFSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin Levels: < 1.0 EU per ug protein as determined by the LAL method.
Buffer: The recombinant FSH was lyophilized from a concentrated (1 mg/ml) solution containing PBS.
Storage Conditions: Lyophilized recombinant FSH although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FSH should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Monomer or Dimer

Size

, ,

Tag

Applications

Product Type

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Human FSH Protein