PDF DatasheetHuman GNLY Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant GNLY based upon sequence from Human
Host: QP12021 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of GNLY was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Granulysin in sterile 18MΩ.cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: Untested
Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH
Purity: Greater than 95.0% as determined by SDS-PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The Granulysin protein was lyophilized from a concentrated (1 mg/ml) solution containing no additives.
Storage Conditions: Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Granulysin should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
| Recombinant Human GNLY General Information | |
|---|---|
| Alternate Names | |
| LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E. | |
| Molecular Weight | |
| 18.1 kDa | |
| Curated Database and Bioinformatic Data | |
| UniProt ID(s) | P22749 |
| General Description of Recombinant Human GNLY. | |
| Human GNLY produced in E. Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa. The GNLY is purified by using an optimized multi-step FPLC method for maximum separation from contaminants. | |
Limitations and Performance Guarantee
enQuire Bio’s products are supplied for LABORATORY RESEARCH USE ONLY. The product may not be used for any other purpose. This product is guaranteed to work for a period of one year when stored at -70°C or colder.
There are no reviews yet.