Hepatitis C HCV NS4 a+b Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant HCV NS4 a+b based upon sequence from Hepatitis C
Host: QP12178 protein expressed in E. Coli.
Available Tags: Biotin, Beta-galactosidase, FITC
Protein Construction: A cDNA sequence encoding the sequence of HCV NS4 a+b was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Additional Testing: Confirmed to react with antibodies from sera of HCV-infected individuals.
Bioactivity Data: Untested
Amino Acid Sequence: 1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863
Purity: HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining).
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: (1 mg/ml) 20mM Tris-HCl pH 8 and 8M urea.
Storage Conditions: HCV NS4 a+b Biotin although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Physical Appearance: Sterile Colorless Liquid
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
There are no reviews yet.