Recombinant HIV-1 Integrase Protein

$ 150.00$ 1,200.00

SKU: QP12252
Species: HIV
Applications: See Application Notes
Available Tags: His
Available Hosts: E. Coli
Purity: Greater than 95.0% as determined by SDS-PAGE.
Length (Amino Acids):

SKU: QP12252-100ug Categories: , , , , Tag:
 PDF Datasheet

HIV HIV-1 Integrase Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant HIV-1 Integrase based upon sequence from HIV
Host: QP12252 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of HIV-1 Integrase was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes

Additional Testing: Immunoreactive with all sera of HIV-1 infected individuals.
Bioactivity Data: Untested
Amino Acid Sequence: mfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilklagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedhhhhhh
Purity: Greater than 95.0% as determined by SDS-PAGE.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: 1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X & 50% Glycerol.
Storage Conditions: HIV-1 Integrase although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Physical Appearance: Sterile filtered clear solution.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Size

, ,

Tag

Applications

Product Type

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant HIV-1 Integrase Protein