Recombinant HIV-2 gp-36 397aa Protein

$ 150.00$ 1,200.00

SKU: QP12270
Species: HIV
Applications: See Application Notes
Available Tags: Untagged
Available Hosts: E. Coli
Purity: Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Length (Amino Acids):

SKU: QP12270-100ug Categories: , , , , Tag:
 PDF Datasheet

HIV HIV-2 gp-36 397aa Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant HIV-2 gp-36 397aa based upon sequence from HIV
Host: QP12270 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of HIV-2 gp-36 397aa was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes

Additional Testing: Reactive with human HIV positive serum.
Bioactivity Data: Untested
Amino Acid Sequence: EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNSWDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQMLSRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGGSNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC
Purity: Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: 0.01M Na2CO3, 0.01M Na3EDTA, 0.014 Mb-mercaptoethanol, 0.05% Tween-20.
Storage Conditions: HIV-2 gp-36 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Physical Appearance: Sterile filtered clear solution.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Size

, ,

Tag

Applications

Product Type

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant HIV-2 gp-36 397aa Protein