Human MOG Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant MOG based upon sequence from Human
Host: QP12718 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of MOG was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized MOG in sterile 10mM Acetic acid not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: Untested
Amino Acid Sequence: MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH
Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The Myelin Oligodendrocyte Glycoprotein 0.5 mg/ml solution was lyophilized from 20mM sodium acetate buffer pH 4 and 0.3M sodium chloride.
Storage Conditions: Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Recombinant Human MOG General Information | |
---|---|
Alternate Names | |
Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137. | |
Molecular Weight | |
15.2 kDa | |
Curated Database and Bioinformatic Data | |
UniProt ID(s) | Q16653 |
General Description of Recombinant Human MOG. | |
Myelin Oligodendrocyte Glycoprotein produced in E. Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 AA + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa. |
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
There are no reviews yet.