Recombinant Pramlintide Protein

$ 98.00$ 558.00

SKU: QP13132
Species: other
Applications: See Application Notes
Available Tags: Untagged
Available Hosts: E. Coli
Purity: Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Length (Amino Acids):

SKU: QP13132-1mg Categories: , , , , Tag:
 PDF Datasheet

other Pramlintide Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant Pramlintide based upon sequence from other
Host: QP13132 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of Pramlintide was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes

Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Pramlintide in sterile 18MΩ.cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid.
Bioactivity Data: Untested
Amino Acid Sequence: KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
Purity: Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The protein was lyophilized with no additives.
Storage Conditions: Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Size

, ,

Tag

Applications

Product Type

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Pramlintide Protein