PDF Datasheetother Protein G Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant Protein G based upon sequence from other
Host: QP13162 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of Protein G was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Recommended Reconstitution Instructions: Reconstitution with deionized water or PBS.
Additional Testing: 1. IgG Binding activity Under optimal conditions: 1 mg protein G will bind ~5 mg. human IgG at pH 5-6.2. IgG Binding Sites: 3 sites. 3. Isoelectric Point: 4.55.4. Binds with greater affinity to most mammalian immunoglobulins than Protein A, including human IgG3 and rat IgG2a. 5. Does not bind to human IgM, IgD and IgA.
Bioactivity Data: Untested
Amino Acid Sequence: LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Purity: >96% as determined by SDS-PAGE and RP-HPLC.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: Lyophilized white powder containing no additives.
Storage Conditions: Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Protein G should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
There are no reviews yet.