Placeholder

Recombinant Rat CNTF Protein

$ 89.00$ 2,700.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP10559
Species: Rat
Applications: Bioactive
Available Tags: Untagged
Available Hosts: E. Coli
Purity: Greater than 99.0% as determined by:(a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP10559-5ug Size: 5 ug, Tag: Untagged (Native Protein) $ 89.00
QP10559-25ug Size: 25 ug, Tag: Untagged (Native Protein) $ 130.00
QP10559-1mg Size: 1 mg, Tag: Untagged (Native Protein) $ 2,700.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP10559-5ug
Recombinant Rat CNTF General Information
Alternate Names
HCNTF, CNTF, Ciliary Neurotrophic Factor.
Molecular Weight
22.8 kDa
Curated Database and Bioinformatic Data
UniProt ID(s)P20294
General Description of Recombinant Rat CNTF.
CNTF Recombinant Rat produced in E. Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by using an optimized multi-step FPLC method for maximum separation from contaminants.

Rat CNTF Bioactive Protein Product Attributes

Product Type: Bioactive Protein
Recombinant CNTF based upon sequence from Rat
Host: QP10559 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of CNTF was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
Bioactivity Data: Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
Amino Acid Sequence: AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Purity: Greater than 99.0% as determined by:(a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
Endotoxin Levels: < 1.0 EU per ug protein as determined by the LAL method.
Buffer: Lyophilized from a concentrated (1 mg/ml) solution in water containing 0.025% NaHCO3.
Storage Conditions: Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CNTF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Rat CNTF Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Rat CNTF Protein