Rat CNTF Bioactive Protein Product Attributes
Product Type: Bioactive Protein
Recombinant CNTF based upon sequence from Rat
Host: QP10559 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of CNTF was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
Bioactivity Data: Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
Amino Acid Sequence: AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Purity: Greater than 99.0% as determined by:(a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
Endotoxin Levels: < 1.0 EU per ug protein as determined by the LAL method.
Buffer: Lyophilized from a concentrated (1 mg/ml) solution in water containing 0.025% NaHCO3.
Storage Conditions: Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CNTF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Limitations and Performance Guarantee
enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
There are no reviews yet.