Placeholder

Recombinant Human En Protein

$ 89.00$ 990.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP10586
Species: Human
Applications: Bioactive
Available Tags: His
Available Hosts: Insect
Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Length (Amino Acids):

Size
Tag Clear selection
Shipping Information
1-3 days
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
SKU: QP10586-2ug
Recombinant Human En General Information
Alternate Names
CD105, ENG, END, ORW, HHT1, ORW1, FLJ41744, Endoglin.
Molecular Weight
61 kDa
Chromosomal Location
q34.11 on chromosome 9
Curated Database and Bioinformatic Data
Gene SymbolENG
Entrez Gene ID2022
UniProt ID(s)P17813
COSMIC ID Link(s)ENG
KEGG Gene ID(s)hsa:2022
General Description of Recombinant Human En.
Human CD105 extracellular domain produced in baculovirus is a homodimeric, glycosylated, Polypeptide containing 586 amino acids and having a molecular mass of 61 kDa but as a result of glycosylation, migrates at 90 kDa under reducing conditions in SDS-PAGE. The CD105 is fused to a C-terminal His-tag (6xHis) and purified by using an optimized multi-step FPLC method for maximum separation from contaminants.

Human En Bioactive Protein Product Attributes

Product Type: Bioactive Protein
Recombinant En based upon sequence from Human
Host: QP10586 protein expressed in Insect.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of En was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized CD-105 in sterile PBS not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: Measured by its ability to bind with rhTGF-beta RII/Fc in a functional ELISA. Optimal dilutions should be determined by each laboratory for each application.
Monomer or Dimer: Dimer
Amino Acid Sequence: MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTY TTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVL SVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPI TSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLE GVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLID ANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPL ASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKE LVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNI LSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSE FLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPI PKTGTLSCTVALRPKTGS
Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Endotoxin Levels:
Buffer: Endoglin was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1xPBS.
Storage Conditions: Lyophilized Endoglin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD105 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human En Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif

enQuire Bio, LLC   1825 Lawrence St, Ste 115   Denver, CO 80202
Phone: 1-855-344-1400 | enquire@enquirebio.com | Fax: 1-855-344-1400
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email
Scroll to top

We consume cookies ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it. Dismiss

Recombinant Human En Protein