Placeholder

Recombinant Human FLT1 D3 Protein

$ 98.00$ 1,108.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP10612
Species: Human
Applications: Bioactive
Available Tags: Untagged
Available Hosts: Insect
Purity: Greater than 90.0% as determined by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP10612-2ug Size: 2 ug, Tag: Untagged (Native Protein) $ 89.00
QP10612-10ug Size: 10 ug, Tag: Untagged (Native Protein) $ 130.00
QP10612-100ug Size: 100 ug, Tag: Untagged (Native Protein) $ 990.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP10612-2ug
Recombinant Human FLT1 D3 General Information
FLT1 D3  protein 3D structural model from Catalog of Somatic Mutations in Cancer originally published in the paper COSMIC: somatic cancer genetics at high-resolution
Alternate Names
FLT-1, FLT1, Tyrosine-protein kinase receptor FLT, Flt-1, Tyrosine-protein kinase FRT, Fms-like tyrosine kinase 1, VEGFR-1.
Molecular Weight
45 kDa
Chromosomal Location
q12.3 on chromosome 13
Curated Database and Bioinformatic Data
Gene SymbolFLT1
Entrez Gene ID2321
UniProt ID(s)P17948
COSMIC ID Link(s)FLT1
KEGG Gene ID(s)hsa:2321
General Description of Recombinant Human FLT1 D3.
Human FLT1 D1-3 produced in Baculovirus is monomeric, glycosylated, polypeptide containing 327 amino acids and having a molecular mass of 45 kDa. The soluble receptor protein contains only the first 3 extracellular domains, which contain all the information necessary for binding of VEGF. The FLT1 is purified by using an optimized multi-step FPLC method for maximum separation from contaminants.

Human FLT1 D3 Bioactive Protein Product Attributes

Product Type: Bioactive Protein
Recombinant FLT1 D3 based upon sequence from Human
Host: QP10612 protein expressed in Insect.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of FLT1 D3 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized FLT1 D3 in sterile water not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: The activity of FLT1D1-3 was determined by its ability to inhibit the VEGF-165-induced proliferation of HUVE cells.
Amino Acid Sequence: SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSY
Purity: Greater than 90.0% as determined by SDS-PAGE.
Endotoxin Levels: < 1.0 EU per ug protein as determined by the LAL method.
Buffer: FLT1 D1-3 was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1xPBS.
Storage Conditions: Lyophilized FLT-1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FLT1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human FLT1 D3 Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Human FLT1 D3 Protein