Placeholder

Recombinant Human FSH Protein

$ 89.00$ 5,200.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP10620
Species: Human
Applications: Bioactive
Available Tags: Untagged
Available Hosts: HEK 293
Purity: Greater than 95% as determined by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP10620-2ug Size: 2 ug, Tag: Untagged (Native Protein) $ 89.00
QP10620-10ug Size: 10 ug, Tag: Untagged (Native Protein) $ 130.00
QP10620-1mg Size: 1 mg, Tag: Untagged (Native Protein) $ 5,200.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP10620-2ug
Recombinant Human FSH General Information
Alternate Names
Follitropin subunit beta, Follicle-stimulating hormone beta subunit, FSH-beta, FSH-B, Follitropin beta chain, FSH.
Curated Database and Bioinformatic Data
UniProt ID(s)P01225
General Description of Recombinant Human FSH.
Human FSH Human Recombinant produced in HEK-293 cells is heterodimeric, glycosylated, polypeptide chain transfected with two expression plasmids encoding the human FSH-alpha chain (Accession # P01215) (Ala25-Ser116) and human FSH-beta chain (Asn19-Glu129) (Accession # P01225) having a total MW of 38kDa. FSH is purified by using an optimized multi-step FPLC method for maximum separation from contaminants.

Human FSH Bioactive Protein Product Attributes

Product Type: Bioactive Protein
Recombinant FSH based upon sequence from Human
Host: QP10620 protein expressed in HEK 293.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of FSH was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Follicle Stimulating Hormone in sterile 18MΩ.cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: The ED50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml.
Monomer or Dimer: Dimer
Amino Acid Sequence: FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSFSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin Levels: < 1.0 EU per ug protein as determined by the LAL method.
Buffer: The recombinant FSH was lyophilized from a concentrated (1 mg/ml) solution containing PBS.
Storage Conditions: Lyophilized recombinant FSH although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FSH should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human FSH Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Human FSH Protein