Placeholder

Recombinant Rabbit GHBP Protein

$ 89.00$ 3,360.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP10642
Species: Rabbit
Applications: Bioactive
Available Tags: Untagged
Available Hosts: E. Coli
Purity: Greater than 98.0% as determined bySDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP10642-5ug Size: 5 ug, Tag: Untagged (Native Protein) $ 98.00
QP10642-20ug Size: 20 ug, Tag: Untagged (Native Protein) $ 148.00
QP10642-1mg Size: 1 mg, Tag: Untagged (Native Protein) $ 3,768.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP10642-5ug
Recombinant Rabbit GHBP General Information
Alternate Names
GHR, GHBP, GH receptor, Somatotropin receptor.
Molecular Weight
28 kDa
Curated Database and Bioinformatic Data
UniProt ID(s)P19941
General Description of Recombinant Rabbit GHBP.
Growth Hormone Binding Protein Rabbit Extracellular Domain Recombinant produced in E. Coli is a single, non-glycosylated, polypeptide chain containing 249 amino acids and having a molecular mass of 28 kDa. GHBP Rabbit is purified by using an optimized multi-step FPLC method for maximum separation from contaminants.

Rabbit GHBP Bioactive Protein Product Attributes

Product Type: Bioactive Protein
Recombinant GHBP based upon sequence from Rabbit
Host: QP10642 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of GHBP was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized GHBP Rabbit in sterile 0.4% NaHCO3 pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
Amino Acid Sequence: AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP
Purity: Greater than 98.0% as determined bySDS-PAGE.
Endotoxin Levels: < 1.0 EU per ug protein as determined by the LAL method.
Buffer: The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1 mg/ml) solution with 0.0045mM NaHCO3.
Storage Conditions: Lyophilized Growth Hormone Binding Protein Rabbit although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GHBP Rabbit should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Rabbit GHBP Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Rabbit GHBP Protein