Placeholder

Recombinant Human IL-12 Protein

$ 89.00$ 1,100.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP10723
Species: Human
Applications: Bioactive
Available Tags: Untagged
Available Hosts: HEK 293
Purity: Greater than 95% as obsereved by SDS-PAGE.
Length (Amino Acids):

Size
Tag Clear selection
Shipping Information
1-3 days
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
SKU: QP10723-2ug

Human IL-12 Bioactive Protein Product Attributes

Product Type: Bioactive Protein
Recombinant IL-12 based upon sequence from Human
Host: QP10723 protein expressed in HEK 293.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of IL-12 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized IL12 in sterile PBS containing 0.1% endotoxin-free recombinant HSA.
Bioactivity Data: The specific activity was determined by the dose-dependent release of IFN-gamma from the human NK92 cell line in presence of 20ng/mL rIL-2. The EC50 is 0.5ng/ml.
Monomer or Dimer: Dimer
Amino Acid Sequence: IL-12 is a heterodimer of IL-12A and IL-12B linked through a disulfide-bond between cysteines in red in sequences below>IL-12 ARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS>IL-12BIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Purity: Greater than 95% as obsereved by SDS-PAGE.
Endotoxin Levels:
Buffer: IL12 was lyophilized from a 0.2µm filtered solution containing 1xPBS.
Storage Conditions: Lyophilized IL-12 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL12 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bios products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human IL-12 Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif

enQuire Bio, LLC   1825 Lawrence St, Ste 115   Denver, CO 80202
Phone: 1-855-344-1400 | enquire@enquirebio.com | Fax: 1-855-344-1400
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email
Scroll to top

We consume cookies ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it. Dismiss

Recombinant Human IL-12 Protein