Placeholder

Recombinant Mouse IL17E Protein

$ 89.00$ 2,700.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP10725
Species: Mouse
Applications: Bioactive
Available Tags: Untagged
Available Hosts: E. Coli
Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP10725-5ug Size: 5 ug, Tag: Untagged (Native Protein) $ 89.00
QP10725-25ug Size: 25 ug, Tag: Untagged (Native Protein) $ 130.00
QP10725-1mg Size: 1 mg, Tag: Untagged (Native Protein) $ 2,700.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP10725-5ug
Recombinant Mouse IL17E General Information
Alternate Names
IL-25, IL-17E, IL17E, IL25, Interleukin-25.
Molecular Weight
35.5 kDa
Chromosomal Location
C2 on chromosome 14
Curated Database and Bioinformatic Data
Gene SymbolIl25
Entrez Gene ID140806
UniProt ID(s)Q8VHH8
COSMIC ID Link(s)Il25
KEGG Gene ID(s)mmu:140806
General Description of Recombinant Mouse IL17E.
Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing 2x145 amino acid chains, with a total molecular weight of 35.5 kDa. The Mouse IL-17E is purified by using an optimized multi-step FPLC method for maximum separation from contaminants.

Mouse IL17E Bioactive Protein Product Attributes

Product Type: Bioactive Protein
Recombinant IL17E based upon sequence from Mouse
Host: QP10725 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of IL17E was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 10mM HCl at a concentration not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml.
Monomer or Dimer: Dimer
Amino Acid Sequence: VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA
Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Endotoxin Levels: < 1.0 EU per ug protein as determined by the LAL method.
Buffer: IL17E was lyophilized from a concentrated (1 mg/ml) solution containing no additives.
Storage Conditions: Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Mouse IL17E Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Mouse IL17E Protein