Placeholder

Recombinant Mouse Noggin Protein

$ 98.00$ 3,938.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP10795
Species: Mouse
Applications: Bioactive
Available Tags: Untagged
Available Hosts: E. Coli
Purity: Greater than 95.0% as determined by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP10795-5ug Size: 5 ug, Tag: Untagged (Native Protein) $ 89.00
QP10795-20ug Size: 20 ug, Tag: Untagged (Native Protein) $ 130.00
QP10795-1mg Size: 1 mg, Tag: Untagged (Native Protein) $ 3,510.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP10795-5ug
Recombinant Mouse Noggin General Information
Alternate Names
Noggin, SYM1, SYNS1, NOG.
Molecular Weight
approximately 46.4 kDa
Curated Database and Bioinformatic Data
UniProt ID(s)P97466
General Description of Recombinant Mouse Noggin.
Mouse Noggin produced in E. Coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa).

Mouse Noggin Bioactive Protein Product Attributes

Product Type: Bioactive Protein
Recombinant Noggin based upon sequence from Mouse
Host: QP10795 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of Noggin was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes
Recommended Reconstitution Instructions: It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions.
Bioactivity Data: The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg in the presence of 5ng/ml BMP-4.
Amino Acid Sequence: MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC
Purity: Greater than 95.0% as determined by SDS-PAGE.
Endotoxin Levels: < 1.0 EU per ug protein as determined by the LAL method.
Buffer: Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.
Storage Conditions: Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Mouse Noggin Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Mouse Noggin Protein