Recombinant Mouse Noggin Protein

Price range: $ 108.00 through $ 4,148.00

SKU: QP10795
Species: Mouse
Applications: Bioactive
Available Tags: Untagged
Available Hosts: E. Coli
Purity: Greater than 95.0% as determined by SDS-PAGE.
Length (Amino Acids):

SKU: QP10795-5ug Categories: , , , Tag:
 PDF Datasheet

Mouse Noggin Bioactive Protein Product Attributes

Product Type: Bioactive Protein
Recombinant Noggin based upon sequence from Mouse
Host: QP10795 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of Noggin was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes

Recommended Reconstitution Instructions: It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions.
Bioactivity Data: The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg in the presence of 5ng/ml BMP-4.
Amino Acid Sequence: MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC
Purity: Greater than 95.0% as determined by SDS-PAGE.
Endotoxin Levels: < 1.0 EU per ug protein as determined by the LAL method.
Buffer: Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.
Storage Conditions: Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio’s products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Size

, ,

Tag

Applications

Product Type

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Mouse Noggin Protein