Placeholder

Recombinant Human PRL R Protein

$ 89.00$ 3,360.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP10846
Species: Human
Applications: Bioactive
Available Tags: Untagged
Available Hosts: E. Coli
Purity: Greater than 97.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions.
Length (Amino Acids):

Size
Tag Clear selection
Shipping Information
1-3 days
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
SKU: QP10846-5ug
Recombinant Human PRL R General Information
Alternate Names
PRL-R, hPRLrI.
Molecular Weight
23.97 kDa
Curated Database and Bioinformatic Data
UniProt ID(s)P16471
General Description of Recombinant Human PRL R.
Human Extra Cellular Domain Prolactin Receptor produced in E. Coli is a non-glycosylated, Polypeptide chain containing 210 amino acids and having a molecular mass of 23.97 kDa. The Prolactin Receptor is purified by using an optimized multi-step FPLC method for maximum separation from contaminants. according to Bignon et al. (1994) JBC 269.3318-24 and tested according to Gertler et al. (1996) JBC 271.24482-91.

Human PRL R Bioactive Protein Product Attributes

Product Type: Bioactive Protein
Recombinant PRL R based upon sequence from Human
Host: QP10846 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of PRL R was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized PRLR in sterile 18M-cm H2O not less than 100µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.
Amino Acid Sequence: AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW
Purity: Greater than 97.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions.
Concentration of Human PRL R Protein: UV spectroscopy at 280 nm using the absorbency value of 2.63 as the extinction coefficient for a 0.1% (1 mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics).
Endotoxin Levels:
Buffer: The Prolactin Receptor was lyophilized from a concentrated (0.4 mg/ml) solution with 0.0045mM NaHCO3.
Storage Conditions: Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles as they cause oligomerization of the protein.
Physical Appearance: Sterile filtered white lyophilized powder.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human PRL R Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif

enQuire Bio, LLC   1825 Lawrence St, Ste 115   Denver, CO 80202
Phone: 1-855-344-1400 | enquire@enquirebio.com | Fax: 1-855-344-1400
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email
Scroll to top

We consume cookies ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it. Dismiss

Recombinant Human PRL R Protein