Placeholder

Recombinant Ag85B Protein

$ 89.00$ 1,000.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP10977
Species: other
Applications: See Application Notes
Available Tags: His
Available Hosts: E. Coli
Purity: Greater than 90.0% as determined by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP10977-2ug Size: 2 ug, Tag: His $ 89.00
QP10977-10ug Size: 10 ug, Tag: His $ 130.00
QP10977-0.1mg Size: 0.1 mg, Tag: His $ 1,000.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP10977-2ug
Recombinant other Ag85B General Information
Alternate Names
Antigen 85-B, 85B, Extracellular alpha-antigen, Antigen 85 complex B, Ag85B, Mycolyl transferase 85B, EC 2.3. 1. -, Fibronectin-binding protein B, 30 kDa extracellular protein, fbpB, A85B, Major Secretory Protein Antigen 85B.
Molecular Weight
30 kDa
Curated Database and Bioinformatic Data
Gene SymbolfbpB
Entrez Gene ID885785
UniProt ID(s)P0C5B9
COSMIC ID Link(s)fbpB
KEGG Gene ID(s)mtc:MT1934; mtu:Rv1886c
General Description of Recombinant other Ag85B.
Ag85B Recombinant His-Tag fusion protein produced in E. Coli is a single, non-glycosylated polypeptide chain having a molecular mass of 30kDa.

other Ag85B Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant Ag85B based upon sequence from other
Host: QP10977 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of Ag85B was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Antigen-85B in sterile 18MΩ.cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: Untested
Amino Acid Sequence: MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Purity: Greater than 90.0% as determined by SDS-PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: Lyophilized with 0.1% glycerol.
Storage Conditions: Ag85B although stable room temperature for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered and lyophilized, though might appear as a solution as a result of the glycerol content.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Ag85B Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Ag85B Protein