Recombinant Hepatitis C HCV NS4 a+b Protein

Price range: $ 150.00 through $ 1,500.00

SKU: QP12178
Species: Hepatitis C
Applications: See Application Notes
Available Tags: Biotin, Beta-galactosidase, FITC
Available Hosts: E. Coli
Purity: HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining).
Length (Amino Acids):

SKU: QP12178-B-100ug Categories: , , , , Tag:
 PDF Datasheet

Hepatitis C HCV NS4 a+b Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant HCV NS4 a+b based upon sequence from Hepatitis C
Host: QP12178 protein expressed in E. Coli.
Available Tags: Biotin, Beta-galactosidase, FITC
Protein Construction: A cDNA sequence encoding the sequence of HCV NS4 a+b was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes

Additional Testing: Confirmed to react with antibodies from sera of HCV-infected individuals.
Bioactivity Data: Untested
Amino Acid Sequence: 1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863
Purity: HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining).
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: (1 mg/ml) 20mM Tris-HCl pH 8 and 8M urea.
Storage Conditions: HCV NS4 a+b Biotin although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Physical Appearance: Sterile Colorless Liquid

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Size

, ,

Tag

, ,

Applications

Product Type

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Hepatitis C HCV NS4 a+b Protein