Placeholder

Recombinant HIV-2 gp-36 397aa Protein

$ 168.00$ 1,348.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP12270
Species: HIV
Applications: See Application Notes
Available Tags: Untagged
Available Hosts: E. Coli
Purity: Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP12270-100ug Size: 100 ug, Tag: Untagged (Native Protein) $ 150.00
QP12270-500ug Size: 500 ug, Tag: Untagged (Native Protein) $ 600.00
QP12270-1mg Size: 1 mg, Tag: Untagged (Native Protein) $ 1,200.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP12270-100ug

HIV HIV-2 gp-36 397aa Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant HIV-2 gp-36 397aa based upon sequence from HIV
Host: QP12270 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of HIV-2 gp-36 397aa was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Additional Testing: Reactive with human HIV positive serum.
Bioactivity Data: Untested
Amino Acid Sequence: EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNSWDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQMLSRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGGSNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC
Purity: Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: 0.01M Na2CO3, 0.01M Na3EDTA, 0.014 Mb-mercaptoethanol, 0.05% Tween-20.
Storage Conditions: HIV-2 gp-36 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Physical Appearance: Sterile filtered clear solution.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant HIV-2 gp-36 397aa Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant HIV-2 gp-36 397aa Protein