Recombinant Mouse IL 17 A/F Protein

Price range: $ 89.00 through $ 1,218.00

SKU: QP12392
Species: Mouse
Applications: See Application Notes
Available Tags: Untagged
Available Hosts: E. Coli
Purity: Greater than 97.0% as determined by SDS-PAGE.
Length (Amino Acids):

SKU: QP12392-2ug Categories: , , , , , Tag:
 PDF Datasheet

Mouse IL 17 A/F Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant IL 17 A/F based upon sequence from Mouse
Host: QP12392 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of IL 17 A/F was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes

Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Mouse IL17 A/F in sterile 18MΩ.cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: Untested
Monomer or Dimer: Dimer
Amino Acid Sequence: RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Purity: Greater than 97.0% as determined by SDS-PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: Lyophilized from a concentrated (1 mg/ml) solution containing no additives.
Storage Conditions: Lyophilized Mouse IL17 A/F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse IL17 A/F should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Monomer or Dimer

Size

, ,

Tag

Applications

Product Type

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Mouse IL 17 A/F Protein