Placeholder

Recombinant Human OTOR Protein

$ 89.00$ 4,680.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP12938
Species: Human
Applications: See Application Notes
Available Tags: Untagged, His
Available Hosts: E. Coli
Purity: Greater than 98.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP12938-5ug Size: 5 ug, Tag: Untagged (Native Protein) $ 89.00
QP12938-HIS-5ug Size: 5 ug, Tag: His $ 89.00
QP12938-20ug Size: 20 ug, Tag: Untagged (Native Protein) $ 130.00
QP12938-HIS-20ug Size: 20 ug, Tag: His $ 130.00
QP12938-1mg Size: 1 mg, Tag: Untagged (Native Protein) $ 3,510.00
QP12938-HIS-1mg Size: 1 mg, Tag: His $ 4,680.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP12938-5ug
Recombinant Human OTOR General Information
Alternate Names
Otoraplin, Fibrocyte-derived protein, Melanoma inhibitory activity-like protein, OTOR, MIAL, FDP, MIAL1, MGC126737, MGC126739.
Molecular Weight
12.7 kDa
Chromosomal Location
p12.1 on chromosome 20
Curated Database and Bioinformatic Data
Gene SymbolOTOR
Entrez Gene ID56914
UniProt ID(s)Q9NRC9
COSMIC ID Link(s)OTOR
KEGG Gene ID(s)hsa:56914
General Description of Recombinant Human OTOR.
Human Otoraplin produced in E. Coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.7 kDa. The OTOR is purified by using an optimized multi-step FPLC method for maximum separation from contaminants.

Human OTOR Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant OTOR based upon sequence from Human
Host: QP12938 protein expressed in E. Coli.
Available Tags: Untagged, His
Protein Construction: A cDNA sequence encoding the sequence of OTOR was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Otoraplin in sterile 18MΩ.cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: Untested
Amino Acid Sequence: VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
Purity: Greater than 98.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The OTOR protein was lyophilized from a concentrated (1 mg/ml) solution containing 20mM PBS pH 7.4 and 130mM NaCl.
Storage Conditions: Lyophilized OTOR Recombinant although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OTOR should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human OTOR Protein”

Your email address will not be published.

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Human OTOR Protein