Placeholder

Recombinant Human p16-INK4a Protein

$ 89.00$ 3,510.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP12946
Species: Human
Applications: See Application Notes
Available Tags: Untagged
Available Hosts: E. Coli
Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP12946-EC-5ug Size: 5 ug, Tag: Untagged (Native Protein) $ 89.00
QP12946-20ug Size: 20 ug, Tag: Untagged (Native Protein) $ 130.00
QP12946-EC-1mg Size: 1 mg, Tag: Untagged (Native Protein) $ 3,510.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP12946-EC-5ug
Recombinant Human p16-INK4a General Information
p16-INK4a  protein 3D structural model from Catalog of Somatic Mutations in Cancer originally published in the paper COSMIC: somatic cancer genetics at high-resolution
Alternate Names
Cyclin-dependent kinase 4 inhibitor A, CDK4I, p16-INK4, p16-INK4a, p16INK4A, CDKN-2A, CDKN2, Multiple tumor suppressor 1, MTS1, CMM2, MLM, TP16, p16(INK4), p19.
Molecular Weight
16.5 kDa
Chromosomal Location
p21.3 on chromosome 9
Curated Database and Bioinformatic Data
Gene SymbolCDKN2A
Entrez Gene ID1029
UniProt ID(s)P42771
COSMIC ID Link(s)CDKN2A
KEGG Gene ID(s)hsa:1029
General Description of Recombinant Human p16-INK4a.
Human CDKN2A produced in E. Coli, it's a single non-glycosylated polypeptide chain containing 156 amino acids, approximately 16.5 kDa. CDKN2A is purified by using an optimized multi-step FPLC method for maximum separation from contaminants.

Human p16-INK4a Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant p16-INK4a based upon sequence from Human
Host: QP12946 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of p16-INK4a was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Cyclin-dependent kinase in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: Untested
Amino Acid Sequence: MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: CDKN2A was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1x PBS pH 7.4.
Storage Conditions: Lyophilized Cyclin-dependent kinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Cyclin-dependent kinase should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human p16-INK4a Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Human p16-INK4a Protein