Placeholder

Recombinant Human PLA2G10 Protein

$ 89.00$ 3,900.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP13071
Species: Human
Applications: See Application Notes
Available Tags: His
Available Hosts: E. Coli
Purity: Greater than 95% as determined by SDS PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP13071-2ug Size: 2 ug, Tag: His $ 89.00
QP13071-10ug Size: 10 ug, Tag: His $ 130.00
QP13071-1mg Size: 1 mg, Tag: His $ 3,900.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP13071-2ug
Recombinant Human PLA2G10 General Information
Alternate Names
Group 10 secretory phospholipase A2, EC 3.1. 1.4, Group X secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase GX, GX sPLA2, sPLA2-X, SPLA2, GXPLA2, MGC119918, MGC119919, MGC133367, PLA2G10.
Curated Database and Bioinformatic Data
UniProt ID(s)O15496
General Description of Recombinant Human PLA2G10.
Human Secreted Phospholipase A2-X is manufactured with N-terminal fusion His Tag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - His Tag (underlined). MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.

Human PLA2G10 Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant PLA2G10 based upon sequence from Human
Host: QP13071 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of PLA2G10 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Recommended Reconstitution Instructions: Add 0.2 ml of distilled water and let the lyophilized pellet dissolve completely.
Bioactivity Data: Untested
Amino Acid Sequence: MGPLPVCLPI MLLLLLPSLL LLLLLPGPGS GEASRILRVH RRGILELAGT VGCVGPRTPI AYMKYGCFCG LGGHGQPRDA IDWCCHGHDC CYTRAEEAGC SPKTERYSWQ CVNQSVLCGP AENKCQELLC KCDQEIANCL AQTEYNLKYL FYPQFLCEPD SPKCD
Purity: Greater than 95% as determined by SDS PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: Sterile filtered and lyophilized from 0.5 mg/ml in 0.01M Tris buffer pH 7.2.
Storage Conditions: Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Physical Appearance: Sterile Filtered lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human PLA2G10 Protein”

Your email address will not be published.

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Human PLA2G10 Protein