Placeholder

Recombinant Human PLA2G2E Protein

$ 89.00$ 3,900.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP13073
Species: Human
Applications: See Application Notes
Available Tags: His
Available Hosts: E. Coli
Purity: Greater than 95% as determined by SDS PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP13073-2ug Size: 2 ug, Tag: His $ 89.00
QP13073-10ug Size: 10 ug, Tag: His $ 130.00
QP13073-1mg Size: 1 mg, Tag: His $ 3,900.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP13073-2ug
Recombinant Human PLA2G2E General Information
Alternate Names
Group IIE secretory phospholipase A2, EC 3.1. 1.4, Phosphatidylcholine 2-acylhydrolase GIIE, GIIE sPLA2, sPLA(2)-IIE, sPLA2-IIE, PLA2G2E.
Curated Database and Bioinformatic Data
UniProt ID(s)Q9NZK7
General Description of Recombinant Human PLA2G2E.
Human Secreted Phospholipase A2-IIE manufactured with N-terminal His-Tag. PLA2G2E His-Tagged Fusion Protein is 15.8 kDa protein containing 123 amino acid residues of the human secreted phospholipase A2-IIE and 16 additional amino acid residues – His-Tag (underlined). MRGSHHHHHHGMASHMNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC.

Human PLA2G2E Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant PLA2G2E based upon sequence from Human
Host: QP13073 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of PLA2G2E was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Recommended Reconstitution Instructions: Add 0.2 ml of 0.1M Acetate buffer pH 4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 ?g/ml. In higher concentrations the solubility of this antigen is limited.
Additional Testing: The amino acid sequence of the recombinant human Secreted Phospholipase A2-IIE is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-IIE without signal sequence.
Bioactivity Data: Untested
Amino Acid Sequence: MKSPHVLVFL CLLVALVTGN LVQFGVMIEK MTGKSALQYN DYGCYCGIGG SHWPVDQTDW CCHAHDCCYG RLEKLGCEPK LEKYLFSVSE RGIFCAGRTT CQRLTCECDK RAALCFRRNL GTYNRKYAHY PNKLCTGPTP PC
Purity: Greater than 95% as determined by SDS PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH 4.
Storage Conditions: Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Physical Appearance: Sterile Filtered lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human PLA2G2E Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Human PLA2G2E Protein