Placeholder

Recombinant Pramlintide Protein

$ 89.00$ 500.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP13132
Species: other
Applications: See Application Notes
Available Tags: Untagged
Available Hosts: E. Coli
Purity: Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP13132-1mg Size: 1 mg, Tag: Untagged (Native Protein) $ 98.00
QP13132-5mg Size: 5 mg, Tag: Untagged (Native Protein) $ 148.00
QP13132-25mg Size: 25 mg, Tag: Untagged (Native Protein) $ 558.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP13132-1mg

other Pramlintide Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant Pramlintide based upon sequence from other
Host: QP13132 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of Pramlintide was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Pramlintide in sterile 18MΩ.cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid.
Bioactivity Data: Untested
Amino Acid Sequence: KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
Purity: Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The protein was lyophilized with no additives.
Storage Conditions: Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Pramlintide Protein”

Your email address will not be published.

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Pramlintide Protein