Placeholder

Recombinant Human SELE Protein

$ 89.00$ 2,000.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP13450
Species: Human
Applications: See Application Notes
Available Tags: His
Available Hosts: HEK 293
Purity: Greater than 95% as determined by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP13450-2ug Size: 2 ug, Tag: His $ 98.00
QP13450-10ug Size: 10 ug, Tag: His $ 148.00
QP13450-1mg Size: 1 mg, Tag: His $ 2,238.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP13450-2ug
Recombinant Human SELE General Information
Alternate Names
E-selectin, Endothelial leukocyte adhesion molecule 1, ELAM-1, Leukocyte-endothelial cell adhesion molecule 2, LECAM2, CD62E antigen, SELE, ELAM1, ELAM, ESEL, CD62E.
Curated Database and Bioinformatic Data
UniProt ID(s)P16581
General Description of Recombinant Human SELE.
Human SELE produced by mammalian expression system in human cells is a single polypeptide chain containing 543 amino acids (22-556). SELE is fused to an 8 amino acid His-tag at C-terminus is purified by using an optimized multi-step FPLC method for maximum separation from contaminants.

Human SELE Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant SELE based upon sequence from Human
Host: QP13450 protein expressed in HEK 293.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of SELE was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized SELE in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: Untested
Amino Acid Sequence: WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: SELE was lyophilized from a 0.2 µM filtered solution of PBS and 4% Mannitol, pH 7.5.
Storage Conditions: Lyophilized SELE although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution SELE should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio's products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant Human SELE Protein”

Your email address will not be published.

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant Human SELE Protein