Placeholder

Recombinant West Nile Virus WNV Pre-M Protein

$ 150.00$ 1,200.00
Please Select Product Options Below To View The Catalog Number.

SKU: QP13965
Species: West Nile Virus
Applications: See Application Notes
Available Tags: His
Available Hosts: E. Coli
Purity: Protein is >95% pure as determined by SDS-PAGE.
Length (Amino Acids):

Product NumberDescriptionPrice
QP13965-100ug Size: 100 ug, Tag: His $ 150.00
QP13965-500ug Size: 500 ug, Tag: His $ 600.00
QP13965-1mg Size: 1 mg, Tag: His $ 1,200.00
Shipping Information
In Stock
Flat Rate Shipping Anywhere in the US: $45
Datasheets and Documentation
Product Datasheet
Certificate of Analysis and Tags (Coming Soon)
Lot Number:

Expiration Date:

Concentration (Write Lyophilized if Lyophilized):

Reconsitution Instructions (Leave Blank if Liquid):

Manufacture Date:

Purity:

Bioactivity (test results eg. IU/ml):


SKU: QP13965-100ug

West Nile Virus WNV Pre-M Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant WNV Pre-M based upon sequence from West Nile Virus
Host: QP13965 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of WNV Pre-M was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Additional Testing: Confirmed to react with antibodies from sera of West Nile virus infected individuals.
Bioactivity Data: Untested
Amino Acid Sequence: MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
Purity: Protein is >95% pure as determined by SDS-PAGE.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: 20mM phosphate buffer pH 7.5.
Storage Conditions: WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Physical Appearance: Sterile Colorless Liquid

Limitations and Performance Guarantee

enQuire Bio's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

There are no reviews yet.

Be the first to review “Recombinant West Nile Virus WNV Pre-M Protein”

Your email address will not be published. Required fields are marked *

Share a Protocol (View Reviewed Protocols Below)

Protocol Title

Materials

Methods

Notes


  protocol submission gif
enQuire Bio, LLC   8420 S Continental Divide Rd, #202   Littleton, CO 80127
Chat: See lower right corner. | enquire@enquirebio.com | Fax: 1-720-897-3730
Customer Service Available M-F 8AM-6PM MST or 24/7 Via Email

Recombinant West Nile Virus WNV Pre-M Protein