Recombinant West Nile Virus WNV Pre-M Protein

Price range: $ 150.00 through $ 1,558.00

SKU: QP13965
Species: West Nile Virus
Applications: See Application Notes
Available Tags: His
Available Hosts: E. Coli
Purity: Protein is >95% pure as determined by SDS-PAGE.
Length (Amino Acids):

SKU: QP13965-100ug Categories: , , , , Tag:
 PDF Datasheet

West Nile Virus WNV Pre-M Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant WNV Pre-M based upon sequence from West Nile Virus
Host: QP13965 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of WNV Pre-M was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes

Additional Testing: Confirmed to react with antibodies from sera of West Nile virus infected individuals.
Bioactivity Data: Untested
Amino Acid Sequence: MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
Purity: Protein is >95% pure as determined by SDS-PAGE.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: 20mM phosphate buffer pH 7.5.
Storage Conditions: WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Physical Appearance: Sterile Colorless Liquid

Limitations and Performance Guarantee

enQuire Bio’s products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Size

, ,

Tag

Applications

Product Type

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant West Nile Virus WNV Pre-M Protein