Mouse IL17E Bioactive Protein Product Attributes
Product Type: Bioactive Protein
Recombinant IL17E based upon sequence from Mouse
Host: QP10725 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of IL17E was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 10mM HCl at a concentration not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml.
Monomer or Dimer: Dimer
Amino Acid Sequence: VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA
Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Endotoxin Levels: < 1.0 EU per ug protein as determined by the LAL method.
Buffer: IL17E was lyophilized from a concentrated (1 mg/ml) solution containing no additives.
Storage Conditions: Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
| Recombinant Mouse IL17E General Information | |
|---|---|
| Alternate Names | |
| IL-25, IL-17E, IL17E, IL25, Interleukin-25. | |
| Molecular Weight | |
| 35.5 kDa | |
| Chromosomal Location | |
| C2 on chromosome 14 | |
| Curated Database and Bioinformatic Data | |
| Gene Symbol | Il25 |
| Entrez Gene ID | 140806 |
| UniProt ID(s) | Q8VHH8 |
| COSMIC ID Link(s) | Il25 |
| KEGG Gene ID(s) | mmu:140806 |
| General Description of Recombinant Mouse IL17E. | |
| Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing 2×145 amino acid chains, with a total molecular weight of 35.5 kDa. The Mouse IL-17E is purified by using an optimized multi-step FPLC method for maximum separation from contaminants. | |
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.


Reviews
There are no reviews yet.