Human PLA2G2E Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant PLA2G2E based upon sequence from Human
Host: QP13073 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of PLA2G2E was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Recommended Reconstitution Instructions: Add 0.2 ml of 0.1M Acetate buffer pH 4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 ?g/ml. In higher concentrations the solubility of this antigen is limited.
Additional Testing: The amino acid sequence of the recombinant human Secreted Phospholipase A2-IIE is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-IIE without signal sequence.
Bioactivity Data: Untested
Amino Acid Sequence: MKSPHVLVFL CLLVALVTGN LVQFGVMIEK MTGKSALQYN DYGCYCGIGG SHWPVDQTDW CCHAHDCCYG RLEKLGCEPK LEKYLFSVSE RGIFCAGRTT CQRLTCECDK RAALCFRRNL GTYNRKYAHY PNKLCTGPTP PC
Purity: Greater than 95% as determined by SDS PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH 4.
Storage Conditions: Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Physical Appearance: Sterile Filtered lyophilized (freeze-dried) powder.
| Recombinant Human PLA2G2E General Information | |
|---|---|
| Alternate Names | |
| Group IIE secretory phospholipase A2, EC 3.1. 1.4, Phosphatidylcholine 2-acylhydrolase GIIE, GIIE sPLA2, sPLA(2)-IIE, sPLA2-IIE, PLA2G2E. | |
| Curated Database and Bioinformatic Data | |
| UniProt ID(s) | Q9NZK7 |
| General Description of Recombinant Human PLA2G2E. | |
| Human Secreted Phospholipase A2-IIE manufactured with N-terminal His-Tag. PLA2G2E His-Tagged Fusion Protein is 15.8 kDa protein containing 123 amino acid residues of the human secreted phospholipase A2-IIE and 16 additional amino acid residues His-Tag (underlined). MRGSHHHHHHGMASHMNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC. | |
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.



Reviews
There are no reviews yet.