Recombinant Human CD48 antigen (CD48) (Active)

SKU: QP15097
Species: Human
Applications: WB, ELISA, and others.
Available Tags: Mammalian cell
Available Hosts: hFc1
Purity: Greater than 90% as determined by SDS-PAGE.
Length (Amino Acids): 27-220aa

This product is currently out of stock and unavailable.

SKU: QP15097
 PDF Datasheet
AT1:AU2

QP15097, CD48 Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant CD48 based upon sequence from Homo sapiens (Human)
Host: QP15097 protein expressed in Mammalian cell.
Available Tags: C-terminal hFc1-tagged
Protein Construction: A cDNA sequence encoding the sequence of CD48 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Western Blot, ELISA and others
Application Notes: Please contact us for application specific information for QP15097.
Bioactivity Data: Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 ug/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml.
Amino Acid Sequence: QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS
Purity: Greater than 90% as determined by SDS-PAGE.
Reconstitution Instructions: See COA, sent with protein.
Endotoxin Levels: Less than 1.0 EU/ug as determined by LAL method.
Buffer: Lyophilized from a 0.2 um sterile filtered PBS, 6% Trehalose, pH 7.4
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Physical Appearance: White powder.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Size

1mg, 100ug, 20ug

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Human CD48 antigen (CD48) (Active)