Sale!

Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active)

Price range: $ 121.80 through $ 851.20

SKU: QP15231
Species: Human
Applications: WB, ELISA, and others.
Available Tags: Mammalian cell
Available Hosts: His
Purity: Greater than 95% as determined by SDS-PAGE.
Length (Amino Acids): 31-274aa

SKU: QP15231 Tag:
 PDF Datasheet
AT1:AU2

QP15231, TACSTD2 Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant TACSTD2 based upon sequence from Homo sapiens (Human)
Host: QP15231 protein expressed in Mammalian cell.
Available Tags: C-terminal 10xHis-tagged
Protein Construction: A cDNA sequence encoding the sequence of TACSTD2 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Western Blot, ELISA and others
Application Notes: Please contact us for application specific information for QP15231.
Bioactivity Data: Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 ug/mL can bind Anti-TROP2 recombinant antibody (CSB-RA023072MA1HU), the EC50 is 0.9108-1.640 ng/mL.
Amino Acid Sequence: QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Purity: Greater than 95% as determined by SDS-PAGE.
Reconstitution Instructions: See COA, sent with protein.
Endotoxin Levels: Less than 1.0 EU/ug as determined by LAL method.
Buffer: Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Physical Appearance: White powder.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Size

1mg, 100ug

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active)