AT1:AU2
QP15294, CCR5 Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant CCR5 based upon sequence from Homo sapiens (Human)
Host: QP15294 protein expressed in Mammalian cell.
Available Tags: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Protein Construction: A cDNA sequence encoding the sequence of CCR5 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Western Blot, ELISA and others
Application Notes: Please contact us for application specific information for QP15294.
Bioactivity Data: Measured by its binding ability in a functional ELISA. Immobilized Human CCR5 at 10 ug/mL can bind Anti-CCR5 recombinant antibody (CSB-RA004844MA1HU). The EC50 is 1.099-1.287 ng/mL.
The VLPs (CSB-MP3838) is negative control.
The VLPs (CSB-MP3838) is negative control.
Amino Acid Sequence: MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Purity: The purity information is not available for VLPs proteins.
Reconstitution Instructions: See COA, sent with protein.
Endotoxin Levels: Less than 1.0 EU/ug as determined by LAL method.
Buffer: Lyophilized from a 0.2 um sterile filtered PBS, 6% Trehalose, pH 7.4.
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Physical Appearance: White powder.
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.



Reviews
There are no reviews yet.