Recombinant Human CD276 antigen (CD276), partial (Active)

SKU: QP15093
Species: Human
Applications: WB, ELISA, and others.
Available Tags: Mammalian cell
Available Hosts: hFc1-Myc
Purity: Greater than 90% as determined by SDS-PAGE.
Length (Amino Acids): 29-245aa

SKU: QP15093 Category:
 PDF Datasheet
AT1:AU2

QP15093, CD276 Recombinant Protein Product Attributes

Product Type: Recombinant Protein

Recombinant CD276 based upon sequence from Homo sapiens (Human)
Host: QP15093 protein expressed in Mammalian cell.

Available Tags: C-terminal hFc1-Myc-tagged

Protein Construction: A cDNA sequence encoding the sequence of CD276 was constructred and used to recombinantly synthesize the protein.

Recommended Applications: Western Blot, ELISA and others

Application Notes: Please contact us for application specific information for QP15093.

Bioactivity Data: Measured by its binding ability in a functional ELISA. Immobilized CD276 at 2 ug/ml can bind Anti-CD276 rabbit monoclonal antibody, the EC50 of human CD276 protein is 1.961-2.243 ng/ml.
Amino Acid Sequence: LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG

Purity: Greater than 90% as determined by SDS-PAGE.

Reconstitution Instructions: See COA, sent with protein.
Endotoxin Levels: Less than 1.0 EU/ug as determined by LAL method.

Buffer: Lyophilized from a 0.2 um sterile filtered PBS, 6% Trehalose, pH 7.4

Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.

Physical Appearance: White powder.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

Size

Recombinant Human CD276 antigen (CD276), partial (Active)