Recombinant Human Kidney-associated antigen 1(KAAG1) (Active)

$ 0.00

SKU: QP15276
Species: Human
Applications: WB, ELISA, and others.
Available Tags: Baculovirus
Available Hosts: His
Purity: Greater than 90% as determined by SDS-PAGE.
Length (Amino Acids): 1-84aa

 PDF Datasheet
AT1:AU2

QP15276, KAAG1 Recombinant Protein Product Attributes

Product Type: Recombinant Protein

Recombinant KAAG1 based upon sequence from Homo sapiens (Human)
Host: QP15276 protein expressed in Baculovirus.

Available Tags: C-terminal 10xHis-tagged

Protein Construction: A cDNA sequence encoding the sequence of KAAG1 was constructred and used to recombinantly synthesize the protein.

Recommended Applications: Western Blot, ELISA and others

Application Notes: Please contact us for application specific information for QP15276.

Bioactivity Data: Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2 ug/mL can bind Anti-KAAG1 recombinant antibody(CSB-RA871385MA1HU). The EC50 is 4.924-6.034 ng/mL.
Amino Acid Sequence: MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK

Purity: Greater than 90% as determined by SDS-PAGE.

Reconstitution Instructions: See COA, sent with protein.
Endotoxin Levels: Less than 1.0 EU/ug as determined by LAL method.

Buffer: Lyophilized from a 0.2 um sterile filtered PBS, 6% Trehalose, pH 7.4

Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.

Physical Appearance: White powder.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Human Kidney-associated antigen 1(KAAG1) (Active)