Anti-DOG-1 / TMEM16A / ANO1 Antibody Clone DG1/447 + DOG-1.1

$ 429.00

SKU: 55107-MSM3
Species: Human
Tested Applications: Flow Cytometry, Immunofluorescence, Immunohistochemistry (IHC)
Available Conjugates: Unconjugated
Isotype: Mouse IgG
Mass Spec Validated?: Not MS Validated

 PDF Datasheet

Human Anti-DOG-1 / TMEM16A / ANO1 Antibody Product Attributes

Species: Human
Tested Applications: Flow Cytometry, Immunofluorescence, Immunohistochemistry (IHC).
Application Notes: Flow Cytometry (0.5-1ug of antibody/million cells in 0.1ml), Immunofluorescence (0.5-1ug of antibody/ml), Immunohistochemistry (IHC) (Formalin-fixed) (0.25-0.5ug of antibody/ml for 30 minutes at RT)
Clonality: Monoclonal
Anti-DOG-1 / TMEM16A / ANO1 Antibody Clone: DG1/447 + DOG-1.1
Clone DG1/447 + DOG-1.1 Host and Isotype: Mouse IgG
Anti-Human DOG-1 / TMEM16A / ANO1 Positive Control Sample: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis, mast cells in the dermis of normal skin.
Cellular Localization of Antibody Cell Surface, Cytoplasm
Buffer and Stabilizer: 10mM PBS with 0.05% BSA & 0.05% azide.
Antibody Concentration: 200ug/ml
Antibody Purification Method:Protein A/G Purified
Immunogen: Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
Storage Conditions: Store at 2 to 8° C (refrigerate). Stable for 24 months when properly stored.

DOG-1 / TMEM16A / ANO1 Previously Observed Antibody Staining Patterns

Limitations and Warranty

enQuire Bio’s DOG-1 / TMEM16A / ANO1 Anti-Human Monoclonal is available for Research Use Only. This antibody is guaranteed to work for a period of two years when properly stored.
Size

Tag

Buffer and Stabilizer

,

Product Type

Host

Isotype

Applications

Species

Mass Spec Validated?

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Anti-DOG-1 / TMEM16A / ANO1 Antibody Clone DG1/447 + DOG-1.1

https://enquirebio.com/wp-content/uploads/2017/10/enQuire-Bio-55107-MSM3-P1-anti-DOG-1-TMEM16A-ANO1-antibody-300x225.jpeg