PDF DatasheetHuman Anti-DOG-1 / TMEM16A / ANO1 Antibody Product Attributes
Species: Human
Tested Applications: Flow Cytometry, Immunofluorescence, Immunohistochemistry (IHC).
Application Notes: Flow Cytometry (0.5-1ug of antibody/million cells in 0.1ml), Immunofluorescence (0.5-1ug of antibody/ml), Immunohistochemistry (IHC) (Formalin-fixed) (0.25-0.5ug of antibody/ml for 30 minutes at RT)
Clonality: Monoclonal
Anti-DOG-1 / TMEM16A / ANO1 Antibody Clone: DOG-1.1
Clone DOG-1.1 Host and Isotype: Mouse IgG1 kappa
Anti-Human DOG-1 / TMEM16A / ANO1 Positive Control Sample: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis, mast cells in the dermis of normal skin.
Cellular Localization of Antibody Cell Surface, Cytoplasm
Buffer and Stabilizer: 10mM PBS with 0.05% BSA & 0.05% azide.
Antibody Concentration: 200ug/ml
Antibody Purification Method:Protein A/G Purified
Immunogen: A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
Storage Conditions: Store at 2 to 8° C (refrigerate). Stable for 24 months when properly stored.
DOG-1 / TMEM16A / ANO1 Previously Observed Antibody Staining Patterns
| DOG-1 / TMEM16A / ANO1 General Information | |
|---|---|
| Alternate Names | |
| Transmembrane member 16A, TMEM16A, Canine1, Anoctamin-1, ANO1 | |
| Molecular Weight | |
| ~114kDa | |
| Chromosomal Location | |
| 11q13.3 | |
| Curated Database and Bioinformatic Data | |
| Gene Symbol | TMEM16A |
| Entrez Gene ID | 55107 |
| Ensemble Gene ID | ENSG00000131620 |
| RefSeq Protein Accession(s) | XP_006718665, XP_006718668, XP_011543433, XP_011543425, XP_011543426, XP_011543431, XP_011543423, XP_016873445, XP_016873446, XP_006718667, XP_011543430, XP_011543427, XP_011543429, NP_060513, XP_011543428 |
| RefSeq mRNA Accession(s) | XM_011545121, XM_011545128, NR_030691, XM_011545124, XM_011545131, XM_006718602, XM_011545123, XM_011545126, XM_011545127, XM_006718604, XM_011545129, XM_017017957, NM_018043, XM_006718605, XM_011545125, XM_017017956 |
| RefSeq Genomic Accession(s) | NC_018922, NC_000011 |
| UniProt ID(s) | Q9NW72, Q5XXA6 |
| UniGene ID(s) | Q9NW72, Q5XXA6 |
| HGNC ID(s) | 21625 |
| Cosmic ID(s) | ANO1 |
| KEGG Gene ID(s) | hsa:55107 |
| PharmGKB ID(s) | PA164715378 |
| General Description of DOG-1 / TMEM16A / ANO1. | |
| Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of Canine1, c-kit in GISTs is nearly identical: 94.4% vs. 94.7%. | |
Limitations and Warranty
enQuire Bio’s DOG-1 / TMEM16A / ANO1 Anti-Human Monoclonal is available for Research Use Only. This antibody is guaranteed to work for a period of two years when properly stored.
There are no reviews yet.