PDF DatasheetHuman PRL R Bioactive Protein Product Attributes
Product Type: Bioactive Protein
Recombinant PRL R based upon sequence from Human
Host: QP10846 protein expressed in E. Coli.
Available Tags: Untagged
Protein Construction: A cDNA sequence encoding the sequence of PRL R was constructred and used to recombinantly synthesize the protein.
Recommended Applications: Bioactive
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized PRLR in sterile 18M-cm H2O not less than 100µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.
Amino Acid Sequence: AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW
Purity: Greater than 97.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions.
Concentration of Human PRL R Protein: UV spectroscopy at 280 nm using the absorbency value of 2.63 as the extinction coefficient for a 0.1% (1 mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics).
Endotoxin Levels: < 1.0 EU per ug protein as determined by the LAL method.
Buffer: The Prolactin Receptor was lyophilized from a concentrated (0.4 mg/ml) solution with 0.0045mM NaHCO3.
Storage Conditions: Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles as they cause oligomerization of the protein.
Physical Appearance: Sterile filtered white lyophilized powder.
| Recombinant Human PRL R General Information | |
|---|---|
| Alternate Names | |
| PRL-R, hPRLrI. | |
| Molecular Weight | |
| 23.97 kDa | |
| Curated Database and Bioinformatic Data | |
| UniProt ID(s) | P16471 |
| General Description of Recombinant Human PRL R. | |
| Human Extra Cellular Domain Prolactin Receptor produced in E. Coli is a non-glycosylated, Polypeptide chain containing 210 amino acids and having a molecular mass of 23.97 kDa. The Prolactin Receptor is purified by using an optimized multi-step FPLC method for maximum separation from contaminants. according to Bignon et al. (1994) JBC 269.3318-24 and tested according to Gertler et al. (1996) JBC 271.24482-91. | |
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
There are no reviews yet.