PDF Datasheetother Ag85B Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant Ag85B based upon sequence from other
Host: QP10977 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of Ag85B was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes
Recommended Reconstitution Instructions: It is recommended to reconstitute the lyophilized Antigen-85B in sterile 18MΩ.cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Bioactivity Data: Untested
Amino Acid Sequence: MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Purity: Greater than 90.0% as determined by SDS-PAGE.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: Lyophilized with 0.1% glycerol.
Storage Conditions: Ag85B although stable room temperature for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered and lyophilized, though might appear as a solution as a result of the glycerol content.
| Recombinant other Ag85B General Information | |
|---|---|
| Alternate Names | |
| Antigen 85-B, 85B, Extracellular alpha-antigen, Antigen 85 complex B, Ag85B, Mycolyl transferase 85B, EC 2.3. 1. -, Fibronectin-binding protein B, 30 kDa extracellular protein, fbpB, A85B, Major Secretory Protein Antigen 85B. | |
| Molecular Weight | |
| 30 kDa | |
| Curated Database and Bioinformatic Data | |
| Gene Symbol | fbpB |
| Entrez Gene ID | 885785 |
| UniProt ID(s) | P0C5B9 |
| COSMIC ID Link(s) | fbpB |
| KEGG Gene ID(s) | mtc:MT1934; mtu:Rv1886c |
| General Description of Recombinant other Ag85B. | |
| Ag85B Recombinant His-Tag fusion protein produced in E. Coli is a single, non-glycosylated polypeptide chain having a molecular mass of 30kDa. | |
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
There are no reviews yet.