Recombinant Gliadin Gamma Wheat Protein

Price range: $ 150.00 through $ 1,200.00

SKU: QP11985
Species: other
Applications: See Application Notes
Available Tags: His
Available Hosts: E. Coli
Purity: Protein is >90% pure.
Length (Amino Acids):

SKU: QP11985-100ug Categories: , , , , Tag:
 PDF Datasheet

other Gliadin Gamma Wheat Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant Gliadin Gamma Wheat based upon sequence from other
Host: QP11985 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of Gliadin Gamma Wheat was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP11985.
Bioactivity Data: Untested
Amino Acid Sequence: MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH
Purity: Protein is >90% pure.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: Gliadin Gamma protein solution (1 mg/ml) in 10mM Tris-HCl pH 7.2.
Storage Conditions: Gliadin Gamma although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Physical Appearance: Sterile Filtered clear solution.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Size

, ,

Tag

Applications

Product Type

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Gliadin Gamma Wheat Protein