PDF DatasheetHSV HSV-2 gB Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant HSV-2 gB based upon sequence from HSV
Host: QP12342 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of HSV-2 gB was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP12342.
Bioactivity Data: Untested
Amino Acid Sequence: MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH
Purity: Protein is >90% pure as determined by SDS PAGE.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: 10mM Phosphate buffer pH 7.6 and 75mM NaCl.
Storage Conditions: HSV-2 gB although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Physical Appearance: Sterile Filtered clear solution.
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
There are no reviews yet.