PDF DatasheetHuman RAC1 Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant RAC1 based upon sequence from Human
Host: QP13249 protein expressed in E. Coli.
Available Tags: Untagged, His
Protein Construction: A cDNA sequence encoding the sequence of RAC1 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP13249.
Bioactivity Data: Untested
Amino Acid Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL
Purity: Greater than 95.0% as determined by SDS-PAGE.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The protein solution contains 20mM Tris-HCl pH 7.5, 2mM EDTA and 1mM DTT.
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Physical Appearance: Sterile Filtered colorless solution.
| Recombinant Human RAC1 General Information | |
|---|---|
| Alternate Names | |
| P21-RAC1, RAC-1, RAC1, RAS-like protein TC25, MIG5, Cell-migration-inducing gene 5 protein, rho family small GTP binding protein Rac1, TC-25, MGC111543. | |
| Molecular Weight | |
| 21.4 kDa | |
| Curated Database and Bioinformatic Data | |
| UniProt ID(s) | P63000 |
| General Description of Recombinant Human RAC1. | |
| Human RAC1 produced in E. Coli is a single, non-glycosylated polypeptide chain containing 192 amino acids and having a molecular mass of 21.4 kDa. | |
Limitations and Performance Guarantee
enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
There are no reviews yet.