PDF DatasheetHuman SYK Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant SYK based upon sequence from Human
Host: QP13656 protein expressed in HEK 293.
Available Tags: Flag Tag
Protein Construction: A cDNA sequence encoding the sequence of SYK was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP13656.
Bioactivity Data: Untested
Amino Acid Sequence: MHHHHHHDYKDDDDKKLMASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGL YLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQES DGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQL EKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKV LHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFG GRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELA PWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTV KKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAES WMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARN VLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVW SFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWT YDVENRPGFAAVELRLRNYYYDVVN
Purity: Greater than 85.0% as determined by SDS-PAGE.
Reconstitution Instructions: |||
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: SYK protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.
Storage Conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Physical Appearance: Sterile filtered colorless solution.
| Recombinant Human SYK General Information | |
|---|---|
 |
|
| Alternate Names | |
| Tyrosine-protein kinase SYK, Spleen tyrosine kinase, p72-Syk, SYK. | |
| Molecular Weight | |
| 74.25 kDa | |
| Chromosomal Location | |
| q22.2 on chromosome 9 | |
| Curated Database and Bioinformatic Data | |
| Gene Symbol | SYK |
| Entrez Gene ID | 6850 |
| UniProt ID(s) | P43405 |
| COSMIC ID Link(s) | SYK |
| KEGG Gene ID(s) | hsa:6850 |
| General Description of Recombinant Human SYK. | |
| Human SYK full length protein (1-635 aa) produced in HEK 293 cells with an N-terminal His-Flag tag, having a molecular weight of 74.25kDa. Human SYK is purified by using an optimized multi-step FPLC method for maximum separation from contaminants. | |
Limitations and Performance Guarantee
enQuire Bio’s products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
There are no reviews yet.