Recombinant Rat Tpc1808 Protein

Price range: $ 98.00 through $ 2,018.00

SKU: QP13791
Species: Rat
Applications: See Application Notes
Available Tags: His
Available Hosts: E. Coli
Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Length (Amino Acids):

SKU: QP13791-10ug Categories: , , , , Tag:
 PDF Datasheet

Rat Tpc1808 Recombinant Protein Product Attributes

Product Type: Recombinant Protein
Recombinant Tpc1808 based upon sequence from Rat
Host: QP13791 protein expressed in E. Coli.
Available Tags: His
Protein Construction: A cDNA sequence encoding the sequence of Tpc1808 was constructred and used to recombinantly synthesize the protein.
Recommended Applications: See Application Notes
Application Notes: Please contact us for application specific information for QP13791.
Bioactivity Data: Untested
Amino Acid Sequence: MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS
Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Reconstitution Instructions: Please Request a COA for your specific lot for reconstitution instructions. COAs are also included in the package when shipped.
Endotoxin Levels: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Buffer: The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.
Storage Conditions: Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C. Please prevent freeze-thaw cycles.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Limitations and Performance Guarantee

enQuire Bio’s products are guaranteed and approved for RESEARCH USE ONLY or manufacturing purposes. This product may not be used as a pharmaceutical agent, or other product intended for human consumption without meeting additional regulatory requirements. This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
Species

Host

Size

, ,

Tag

Applications

Product Type

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Recombinant Rat Tpc1808 Protein