PDF DatasheetHuman Cathepsin B / CTSB Recombinant Protein Product Attributes
Product Type: Recombinant Protein
Recombinant Cathepsin B / CTSB based upon sequence from: Human
Host: QP8562 protein expressed in E. coli.
Tag: GST
Protein Construction: A DNA sequence encoding the Homo sapiens (Human) Cathepsin B / CTSB, was expressed in the hosts and tags indicated. Please select your host/tag option, above.
Application Notes: Please contact us for application specific information for QP8562.
Bioactivity Data: Untested
Full Length? Partial (see sequence information for more details).
Expression Region: Ala82 – Asp333
Amino Acid Sequence: ASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
Purity: Greater than 90% as determined by SDS-PAGE.
Reconstitution Instructions:
Concentration of Human Cathepsin B / CTSB Protein:
Endotoxin Levels: Not determined.
Buffer: Tris-based buffer, 50% glycerol
Storage Conditions: Store at -20C to -80C.
| Recombinant Human Cathepsin B / CTSB Protein General Information | |
|---|---|
| Alternate Names | |
| Cathepsin B; CTSB; CPSB; APPS | |
| Curated Database and Bioinformatic Data | |
| Gene Symbol | CTSB |
| Entrez Gene ID | 1508 |
| Ensemble Gene ID | ENSG00000164733 |
| RefSeq Protein Accession(s) | NP_001899.1 |
| RefSeq mRNA Accession(s) | NM_001908.4, NM_147780.3, NM_147781.3, NM_147782.3, NM_147783.3, XM_006716244.2, XM_006716245.2, XM_011543812.2, XM_017013097.1, XM_017013098.1, XM_017013099.1, XM_017013100.1 |
| UniProt ID(s) | P07858 |
| UniGene ID(s) | Hs.520898 |
| HGNC ID(s) | HGNC:2527 |
| COSMIC ID Link(s) | CTSB |
| KEGG Gene ID(s) | hsa:1508 |
| PharmGKB ID(s) | PA27027 |
| General Description of Recombinant Human Cathepsin B / CTSB Protein. | |
| Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis. | |
Limitations and Performance Guarantee
This is a life science research product (for Research Use Only). This product is guaranteed to work for a period of two years when stored at -70C or colder, and one year when aliquoted and stored at -20C.
There are no reviews yet.